Blend CagriSema 5/5mg – High-Purity Research Peptides
Welcome to our comprehensive resource on Blend CagriSema 5/5mg. As a premier supplier of laboratory-grade compounds, we specialize in providing Blend CagriSema 5/5mg that exceeds 99% purity, ensuring your research yields accurate and reproducible data. Our Blend CagriSema 5/5mg is intended strictly for in vitro and in vivo scientific research.
What is Blend CagriSema 5/5mg?
Blend CagriSema 5/5mg is a sophisticated synthetic peptide used in advanced biochemical research. When you buy Blend CagriSema 5/5mg from a reputable source, you are investing in a molecule synthesized through Solid-Phase Peptide Synthesis (SPPS). This method allows for precise control over the amino acid sequence, resulting in a high-fidelity product suitable for complex research models.
Blend CagriSema 5/5mg Specifications & Data
| Attribute | Technical Details |
|---|---|
| Unit Size | 10 mg/vial |
| Unit Quantity | 1 vial |
| Purity (Mass Spectrometry and UV) | 99.75% |
| Sequence (Cagrilintide) | XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Sequence (Semaglutide) | HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG |
| Molecular Formula(Cagrilintide) | C194H312N54O59S2 |
| Molecular Formula (Semaglutide) | C187H291N45O59 |
| Appearance | Lyophilized White Powder |
| Source | Chemical Synthesis |
| Storage | Lyophilized Blend CagriSema is stable at roomTemperature for 90 days, however it is best to store in a freezerbelow – 8c for any extended period of time. |
| Terms | The products we offer are intended for laboratoryresearch use only. Please familiarize yourself withour terms of service prior to ordering. |
Scientific Research Potential
Peer-reviewed studies suggest that Blend CagriSema 5/5mg exhibits significant potential in the following research domains:
- Molecular Signaling: Analyzing the interaction of Blend CagriSema 5/5mg with cellular receptors to trigger physiological responses.
- Tissue Regeneration: Investigating the structural influence of the peptide on extracellular matrix components.
- Metabolic Pathways: Exploring how Blend CagriSema 5/5mg modulates enzyme activity and metabolic homeostasis.
Why Purchase Blend CagriSema 5/5mg for Your Lab?
Finding a reliable place to buy Blend CagriSema 5/5mg online can be challenging. We offer a “gold standard” service for scientific institutions:
- Verified Purity: Every vial is tested via HPLC and Mass Spectrometry to guarantee 99%+ purity.
- Rapid Shipping: We provide expedited shipping across the United States to keep your research on schedule.
- Wholesale Pricing: Competitive pricing for bulk orders of Blend CagriSema 5/5mg is available for academic and private laboratories.
Storage and Handling Protocols
Proper storage is vital for peptide stability. Store lyophilized Blend CagriSema 5/5mg at -20°C for long-term preservation. Once reconstituted with bacteriostatic water, it should be refrigerated at 2-8°C and used within a short duration to minimize degradation.
Explore Related Research Peptides
Enhance your laboratory research by exploring these complementary compounds:
- Buy Bulk MELANOTAN II 10mg (No Promo Codes)
- Bundle (BPC-157 5mg x5 + TB500 5mg x5)
- MGF Peptide (Mechano Growth Factor) 2mg
External Scientific References
For in-depth analysis of existing literature on this compound, visit the following external link:



