Cagrilintide 5mg – High-Purity Research Peptides

Welcome to our comprehensive resource on Cagrilintide 5mg. As a premier supplier of laboratory-grade compounds, we specialize in providing Cagrilintide 5mg that exceeds 99% purity, ensuring your research yields accurate and reproducible data. Our Cagrilintide 5mg is intended strictly for in vitro and in vivo scientific research.

What is Cagrilintide 5mg?

Cagrilintide 5mg is a sophisticated synthetic peptide used in advanced biochemical research. When you buy Cagrilintide 5mg from a reputable source, you are investing in a molecule synthesized through Solid-Phase Peptide Synthesis (SPPS). This method allows for precise control over the amino acid sequence, resulting in a high-fidelity product suitable for complex research models.

Cagrilintide 5mg Specifications & Data

Attribute	Technical Details
Unit Size	5mg/vial
Unit Quantity	1 vial
Purity (Mass Spectrometry and UV)	99.78%
Sequence	XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula	C194H312N54O59S2
Appearance	Lyophilized White Powder
Source	Chemical Synthesis
Storage	Lyophilized Cagrilintide is stable at roomTemperature for 90 days, however it is best to store in a freezerbelow – 8c for any extended period of time..
Terms	The products we offer are intended for laboratoryresearch use only. Please familiarize yourself withour terms of service prior to ordering.

Scientific Research Potential

Peer-reviewed studies suggest that Cagrilintide 5mg exhibits significant potential in the following research domains:

Molecular Signaling: Analyzing the interaction of Cagrilintide 5mg with cellular receptors to trigger physiological responses.
Tissue Regeneration: Investigating the structural influence of the peptide on extracellular matrix components.
Metabolic Pathways: Exploring how Cagrilintide 5mg modulates enzyme activity and metabolic homeostasis.

Why Purchase Cagrilintide 5mg for Your Lab?

Finding a reliable place to buy Cagrilintide 5mg online can be challenging. We offer a “gold standard” service for scientific institutions:

Verified Purity: Every vial is tested via HPLC and Mass Spectrometry to guarantee 99%+ purity.
Rapid Shipping: We provide expedited shipping across the United States to keep your research on schedule.
Wholesale Pricing: Competitive pricing for bulk orders of Cagrilintide 5mg is available for academic and private laboratories.

Storage and Handling Protocols

Proper storage is vital for peptide stability. Store lyophilized Cagrilintide 5mg at -20°C for long-term preservation. Once reconstituted with bacteriostatic water, it should be refrigerated at 2-8°C and used within a short duration to minimize degradation.

Enhance your laboratory research by exploring these complementary compounds:

External Scientific References

For in-depth analysis of existing literature on this compound, visit the following external link:

View Cagrilintide 5mg Research on PubMed / National Library of Medicine

RESEARCH USE ONLY: This product (Cagrilintide 5mg) is strictly for laboratory research purposes. It is NOT for human or veterinary consumption. All handling must be performed by qualified professionals in a controlled environment.